PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00068434001
Common NameGSBRNA2T00068434001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 212aa    MW: 24785.8 Da    PI: 8.1459
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00068434001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.21.8e-28155204251
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                          pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+v++Ltl+hvkSHLQ
  GSBRNA2T00068434001 155 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMDVQDLTLAHVKSHLQ 204
                          9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-13152205IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-24153204IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-21155206IPR006447Myb domain, plants
PfamPF002496.2E-6156205IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MELFPSQPDL YLKINRRREE QEEEDYKEQE EVQRRLLFGS KASDSDRKAS DHLIHTLQFT  60
SNNEPTKIDH NQERMESLDQ DLRSNFMVRP IRGIPLHQNQ ILDHYYYSPT PPFFFSEVNG  120
QHANPSYSYN LHHRHHRQAQ PQAQRLTAKR GVRAPRMRWT TTLHAHFVHA VQLLGGHERA  180
TPKSVLELMD VQDLTLAHVK SHLQVILSIS S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1834920.0AC183492.1 Brassica oleracea Contig G, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638954.11e-140PREDICTED: probable transcription factor KAN3
SwissprotQ941I21e-107KAN3_ARATH; Probable transcription factor KAN3
TrEMBLA0A078JQR11e-157A0A078JQR1_BRANA; BnaAnng25890D protein
STRINGBra040176.1-P1e-133(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139841825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.12e-89G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]